Physician Assistant - Lake Havasu City - Hayman Daugherty Associates

Physician Assistant (PA) - Urgent Care Job in Arizona Job ID: j Urgent Care Physician Assistant Opportunity near LAKE HAVASU CITY, AZ Are you a skilled Physician Assistant seeking a rewarding opportunity in Urgent Care? Join our dedicated team near LAKE HAVASU CITY, AZ, supportin ...

Orthopedic Physician Assistant · Location: Lake Havasu City, AZ, 86403 · Job Description: · Full job description · At Lakeside Health, we strive to achieve patient satisfaction by providing the highest quality musculoskeletal care, being responsive to our patients' needs, and pro ...

We are seeking Nurse Practitioners and Physician Assistants for our primary care clinics located in Bullhead City, AZ. This is a hospital-employed opportunity joining a multispecialty group. Full-time employment Outpatient only Serving communities in the tri-state area of AZ, NV, ...

· Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team i ...

Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team in L ...

Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team in L ...

We are seeking a full-time clinician to join our team in Lake Havasu, AZ. · Evaluate, diagnose, and treat patients of all ages in an urgent care setting · Manage acute illnesses, injuries, and occupational health visits · ...

We are seeking a full-time clinician to join our team in Lake Havasu, AZ. This role is ideal for clinicians who value variety, autonomy, and meaningful community impact while practicing in a fast-paced, well-supported urgent care environment. · Active, unrestricted AZ license for ...

We are seeking a full-time clinician to join our team in Lake Havasu, AZ. This role is ideal for clinicians who value variety, autonomy, and meaningful community impact while practicing in a fast‑paced, well‑supported urgent care environment. · ...

Weareseekingafull-timecliniciantojoourteaminLakeHavasu,AZ.Thisroleisidealforclinicianswhovaluevariety,autonomy,andmeaningfulcommunityimpactwhilepracticinginafast-paced,wellsupportedurgentcareenvironment. · ...

· About Optima Medical: · Optima Medical is an Arizona-based medical group consisting of 30 locations and over 130+ medical providers, who care for more than 200,000 patients statewide. Our mission is to improve the quality of life throughout Arizona by helping communities "Live ...

Family Medicine Physician Assistant Opportunity in Arizona · About the Job · This is a permanent position for a skilled Family Medicine Physician Assistant to join our multispecialty group at our hospital employed facility in Lake Havasu City, AZ. · Key Details: · <ul style= ...

· Physician Assistant $50/HR - $60/HR+ Parker, AZ Loan Forgiveness · Location: Parker, AZ · We are a Private Family Practice that is looking for a caring and compassionate Physician Assistant. · We have a warm and friendly environment in our office. · We treat Children and Ad ...

Physician / Family Practice Opportunity in Arizona · The hospital and clinics in the region are seeking a dedicated Family Medicine Physician to join their team. The ideal candidate will be passionate about outpatient primary care and have a focus on providing comprehensive care ...

Hematology/Oncology Physician · Join Our Team in Lake Havasu City, Arizona · We are seeking a skilled Hematology/Oncology Physician to join our established team. As a J1 Visa Sponsor, we offer opportunities for both practicing and training physicians. · About the Position: · Prac ...

Nurse Practitioner (NP) - Family Medicine Job in Arizona Job ID: j Primary Care Practitioners Opportunity near LAKE HAVASU CITY, AZ Are you a dedicated Nurse Practitioner or Physician Assistant seeking a fulfilling opportunity in primary care near LAKE HAVASU CITY, AZ? We're look ...

Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.10 shifts per month with call coverage · Average 2 patients per 24-hour call · 8-bed nursery department · Level I nursery with c-sections and deliveries · Clinic hour ...

Gastroenterology opening in AZLocated in Lake Havasu City, AZ - Las Vegas, NV 130m; Phoenix 160m; Flagstaff 160mSeeking BC/BE Gastroenterologist Visa Eligible Hospital will provide the incoming physician an excellent income guarantee along with practice management and consulting ...

An AZ Facility Seeks a Locums Orthopedic Surgeon at Weatherby Healthcare summary:CVWalletExtranet.Domain.Entities.JobShortDescription · Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.Call response time required: 15 mi ...

Interested? Give Weatherby a call today and speak with one of our specialty-specific consultants for available dates and details.Call only coverage up to 21 days per month · 7 - 9 patients per shift with 6 or less daily admissions · Inpatient and outpatient call coverage · Phone ...