an Orthopedic Physician Assistant - Lake Havasu City, AZ

Only for registered members Lake Havasu City, AZ , United States

13 hours ago

Default job background
$85,000 - $135,000 (USD) per year *
* This salary range is an estimation made by beBee
Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team in L ...
Lorem ipsum dolor sit amet
, consectetur adipiscing elit. Nullam tempor vestibulum ex, eget consequat quam pellentesque vel. Etiam congue sed elit nec elementum. Morbi diam metus, rutrum id eleifend ac, porta in lectus. Sed scelerisque a augue et ornare.

Donec lacinia nisi nec odio ultricies imperdiet.
Morbi a dolor dignissim, tristique enim et, semper lacus. Morbi laoreet sollicitudin justo eget eleifend. Donec felis augue, accumsan in dapibus a, mattis sed ligula.

Vestibulum at aliquet erat. Curabitur rhoncus urna vitae quam suscipit
, at pulvinar turpis lacinia. Mauris magna sem, dignissim finibus fermentum ac, placerat at ex. Pellentesque aliquet, lorem pulvinar mollis ornare, orci turpis fermentum urna, non ullamcorper ligula enim a ante. Duis dolor est, consectetur ut sapien lacinia, tempor condimentum purus.
Get full access

Access all high-level positions and get the job of your dreams.



Similar jobs

  • Work in company

    Physician Assistant

    Lakeside Health

    Orthopedic Physician Assistant · Location: Lake Havasu City, AZ, 86403 · Job Description: · Full job description · At Lakeside Health, we strive to achieve patient satisfaction by providing the highest quality musculoskeletal care, being responsive to our patients' needs, and pro ...

    Lake Havasu City $90,000 - $150,000 (USD) per year Full time

    6 days ago

  • Work in company

    an Orthopedic Physician Assistant

    Only for registered members

    · Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team i ...

    Lake Havasu City, AZ, $85,000 - $135,000 (USD) per year

    14 hours ago

  • Work in company

    an Orthopedic Physician Assistant

    Only for registered members

    Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team in L ...

    Lake Havasu City $125,000 - $145,000 (USD)

    1 day ago

  • Work in company

    Nurse Practitioner or Physician Assistant

    Only for registered members

    We are seeking a full-time clinician to join our team in Lake Havasu, AZ. This role is ideal for clinicians who value variety, autonomy, and meaningful community impact while practicing in a fast‑paced, well‑supported urgent care environment. · ...

    Lake Havasu City $60 - $80 (USD)

    3 weeks ago

  • Work in company

    Nurse Practitioner or Physician Assistant

    Only for registered members

    We are seeking a full-time clinician to join our team in Lake Havasu, AZ. This role is ideal for clinicians who value variety, autonomy, and meaningful community impact while practicing in a fast-paced, well-supported urgent care environment. · Active, unrestricted AZ license for ...

    Lake Havasu City $60 - $80 (USD) Full time

    2 weeks ago

  • Work in company

    Nurse Practitioner or Physician Assistant

    Only for registered members

    We are seeking a full-time clinician to join our team in Lake Havasu, AZ. · Evaluate, diagnose, and treat patients of all ages in an urgent care setting · Manage acute illnesses, injuries, and occupational health visits · ...

    Lake Havasu City $60 - $80 (USD) Full time

    3 weeks ago

  • Work in company

    Physician Assistant – New Grads Welcome

    Only for registered members

    · About Optima Medical: · Optima Medical is an Arizona-based medical group consisting of 30 locations and over 130+ medical providers, who care for more than 200,000 patients statewide. Our mission is to improve the quality of life throughout Arizona by helping communities "Live ...

    Lake Havasu City, Arizona

    1 week ago

  • Work in company

    Nurse Practitioner or Physician Assistant

    Only for registered members

    Weareseekingafull-timecliniciantojoourteaminLakeHavasu,AZ.Thisroleisidealforclinicianswhovaluevariety,autonomy,andmeaningfulcommunityimpactwhilepracticinginafast-paced,wellsupportedurgentcareenvironment. · ...

    Lake Havasu City, AZ

    3 weeks ago

  • Family Medicine Physician Assistant Opportunity in Arizona · About the Job · This is a permanent position for a skilled Family Medicine Physician Assistant to join our multispecialty group at our hospital employed facility in Lake Havasu City, AZ. · Key Details: · <ul style= ...

    Lake Havasu City

    3 days ago

  • Work in company

    Physician Assistant 50/HR

    Only for registered members

    · Physician Assistant $50/HR - $60/HR+ Parker, AZ Loan Forgiveness · Location: Parker, AZ · We are a Private Family Practice that is looking for a caring and compassionate Physician Assistant. · We have a warm and friendly environment in our office. · We treat Children and Ad ...

    Parker, Arizona, United States

    1 week ago

  • Physician / Family Practice Opportunity in Arizona · The hospital and clinics in the region are seeking a dedicated Family Medicine Physician to join their team. The ideal candidate will be passionate about outpatient primary care and have a focus on providing comprehensive care ...

    Lake Havasu City

    5 days ago

  • Work in company

    Hematology/Oncology Physician

    Source Medical, LLC.

    Hematology/Oncology Physician · Join Our Team in Lake Havasu City, Arizona · We are seeking a skilled Hematology/Oncology Physician to join our established team. As a J1 Visa Sponsor, we offer opportunities for both practicing and training physicians. · About the Position: · Prac ...

    Lake Havasu City $280,000 - $520,000 (USD) per year Full time

    18 hours ago

  • Work in company

    Facility in AZ Needs a Locums Pediatric Hospitalist

    Weatherby Healthcare

    Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.10 shifts per month with call coverage · Average 2 patients per 24-hour call · 8-bed nursery department · Level I nursery with c-sections and deliveries · Clinic hour ...

    Lake Havasu City

    5 days ago

  • Work in company

    Gastroenterology Physician

    Source Medical, LLC.

    Gastroenterology opening in AZLocated in Lake Havasu City, AZ - Las Vegas, NV 130m; Phoenix 160m; Flagstaff 160mSeeking BC/BE Gastroenterologist Visa Eligible Hospital will provide the incoming physician an excellent income guarantee along with practice management and consulting ...

    Lake Havasu City $150,000 - $200,000 (USD) per year

    1 week ago

  • Work in company

    An AZ Facility Seeks a Locums Orthopedic Surgeon

    Weatherby Healthcare

    An AZ Facility Seeks a Locums Orthopedic Surgeon at Weatherby Healthcare summary:CVWalletExtranet.Domain.Entities.JobShortDescription · Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.Call response time required: 15 mi ...

    Lake Havasu City

    1 day ago

  • Work in company

    A Facility in IN Is Seeking a Locums Radiologist

    Weatherby Healthcare

    If this opportunity sounds right for you, give us a call today to speak with an expert Weatherby consultant for details. · Call only coverage with 15-minute response time · 3 - 5 patients per shift · Both inpatient and outpatient rounding · Fellowship required · Phone consults re ...

    Lake Havasu City

    7 hours ago

  • Work in company

    Facility in Arizona Needs a Locums Urologist

    Weatherby Healthcare

    Interested? Give Weatherby a call today and speak with one of our specialty-specific consultants for available dates and details.Call only coverage up to 21 days per month · 7 - 9 patients per shift with 6 or less daily admissions · Inpatient and outpatient call coverage · Phone ...

    Lake Havasu City

    11 hours ago

  • Work in company

    Obstetrics & Gynecology Physician

    ProLocums

    Obstetrics & Gynecology Physician Job · We are seeking an experienced Obstetrics & Gynecology physician to join our team at Prolocums. This is a unique opportunity to provide coverage for OB Laborist services on a part-time basis. · Type: Part-time, 2 weekends per month · Schedul ...

    Lake Havasu City $210,000 - $420,000 (USD) per year

    3 days ago

  • Work in company

    An AZ Facility Seeks a Locums Orthopedic Surgeon

    Weatherby Healthcare

    Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.Call response time required: 15 minutes · 5 - 7 patients per shift · Hospital setting with inpatient and outpatient care · Average 6 or less admissions during call · Join ...

    Lake Havasu City

    11 hours ago

  • Work in company

    Gastroenterology Physician

    Source Medical, LLC.

    Gastroenterology opening in AZLocated in Lake Havasu City, AZ - Las Vegas, NV 130m; Phoenix 160m; Flagstaff 160mSeeking BC/BE Gastroenterologist Visa Eligible Hospital will provide the incoming physician an excellent income guarantee along with practice management and consulting ...

    Lake Havasu City $3,000,000 - $5,000,000 (USD) per year

    3 days ago