an Orthopedic Physician Assistant - Lake Havasu City, AZ

Orthopedic Physician Assistant · Location: Lake Havasu City, AZ, 86403 · Job Description: · Full job description · At Lakeside Health, we strive to achieve patient satisfaction by providing the highest quality musculoskeletal care, being responsive to our patients' needs, and pro ...

· Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team i ...

Orthopedic Physician Assistant (PA-C) · Established Orthopedic Practice · Lakeside Orthopedic Institute | Lake Havasu City, Arizona · Lakeside Orthopedic Institute is expanding and seeking a high-performing Orthopedic Physician Assistant to join our established surgical team in L ...

We are seeking a full-time clinician to join our team in Lake Havasu, AZ. This role is ideal for clinicians who value variety, autonomy, and meaningful community impact while practicing in a fast‑paced, well‑supported urgent care environment. · ...

We are seeking a full-time clinician to join our team in Lake Havasu, AZ. This role is ideal for clinicians who value variety, autonomy, and meaningful community impact while practicing in a fast-paced, well-supported urgent care environment. · Active, unrestricted AZ license for ...

We are seeking a full-time clinician to join our team in Lake Havasu, AZ. · Evaluate, diagnose, and treat patients of all ages in an urgent care setting · Manage acute illnesses, injuries, and occupational health visits · ...

· About Optima Medical: · Optima Medical is an Arizona-based medical group consisting of 30 locations and over 130+ medical providers, who care for more than 200,000 patients statewide. Our mission is to improve the quality of life throughout Arizona by helping communities "Live ...

Weareseekingafull-timecliniciantojoourteaminLakeHavasu,AZ.Thisroleisidealforclinicianswhovaluevariety,autonomy,andmeaningfulcommunityimpactwhilepracticinginafast-paced,wellsupportedurgentcareenvironment. · ...

Family Medicine Physician Assistant Opportunity in Arizona · About the Job · This is a permanent position for a skilled Family Medicine Physician Assistant to join our multispecialty group at our hospital employed facility in Lake Havasu City, AZ. · Key Details: · <ul style= ...

· Physician Assistant $50/HR - $60/HR+ Parker, AZ Loan Forgiveness · Location: Parker, AZ · We are a Private Family Practice that is looking for a caring and compassionate Physician Assistant. · We have a warm and friendly environment in our office. · We treat Children and Ad ...

Physician / Family Practice Opportunity in Arizona · The hospital and clinics in the region are seeking a dedicated Family Medicine Physician to join their team. The ideal candidate will be passionate about outpatient primary care and have a focus on providing comprehensive care ...

Hematology/Oncology Physician · Join Our Team in Lake Havasu City, Arizona · We are seeking a skilled Hematology/Oncology Physician to join our established team. As a J1 Visa Sponsor, we offer opportunities for both practicing and training physicians. · About the Position: · Prac ...

Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.10 shifts per month with call coverage · Average 2 patients per 24-hour call · 8-bed nursery department · Level I nursery with c-sections and deliveries · Clinic hour ...

Gastroenterology opening in AZLocated in Lake Havasu City, AZ - Las Vegas, NV 130m; Phoenix 160m; Flagstaff 160mSeeking BC/BE Gastroenterologist Visa Eligible Hospital will provide the incoming physician an excellent income guarantee along with practice management and consulting ...

An AZ Facility Seeks a Locums Orthopedic Surgeon at Weatherby Healthcare summary:CVWalletExtranet.Domain.Entities.JobShortDescription · Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.Call response time required: 15 mi ...

If this opportunity sounds right for you, give us a call today to speak with an expert Weatherby consultant for details. · Call only coverage with 15-minute response time · 3 - 5 patients per shift · Both inpatient and outpatient rounding · Fellowship required · Phone consults re ...

Interested? Give Weatherby a call today and speak with one of our specialty-specific consultants for available dates and details.Call only coverage up to 21 days per month · 7 - 9 patients per shift with 6 or less daily admissions · Inpatient and outpatient call coverage · Phone ...

Obstetrics & Gynecology Physician Job · We are seeking an experienced Obstetrics & Gynecology physician to join our team at Prolocums. This is a unique opportunity to provide coverage for OB Laborist services on a part-time basis. · Type: Part-time, 2 weekends per month · Schedul ...

Get in touch with a Weatherby consultant today to learn more about this and other opportunities available now.Call response time required: 15 minutes · 5 - 7 patients per shift · Hospital setting with inpatient and outpatient care · Average 6 or less admissions during call · Join ...

Gastroenterology opening in AZLocated in Lake Havasu City, AZ - Las Vegas, NV 130m; Phoenix 160m; Flagstaff 160mSeeking BC/BE Gastroenterologist Visa Eligible Hospital will provide the incoming physician an excellent income guarantee along with practice management and consulting ...