Project Engineer - Cape Canaveral, FL

The Lockheed Martin Fleet Ballistic Missile (FBM) team has supported the U.S. Navy's mission to provide an affordable and credible strategic defense for over 60 years. · We offer unique career opportunities and challenges on a program with a rich history and exciting future. We h ...

The FBM program needs a Project-Engineering-focused professional who will plan, schedule, write, integrate and control the lifecycle of all technical data product that support war-fighter operations missile-system assembly test and maintenance. · ...

The FBM program needs a Project-Engineering-focused professional who will plan, schedule, integrate and control the lifecycle of all technical data product that support war-fighter operations missile-system assembly test and maintenance. · Assist with schedule development – updat ...

Protecting what matters most is the mission that matters most. Space is a critical domain, connecting our technologies, our security and our humanity. · ...

This position performs work on the UK Technical Support Contract (TSC) of the Fleet Ballistic Missile (FBM) Program in support of the US/UK Polaris Sales Agreement. · Coordinate programmatic and technical solutions between LM, the US Navy, and the UK related to the UK's TRIDENT I ...

The design team member will support design and construction of Weapons System Infrastructure & Capabilities (WSIC) projects. · Develop and review facility engineering design packages. · Evaluate designs for compliance with engineering principles. · ...

The Construction Project Engineer is responsible for supporting the execution of assigned projects and the achievement of the project's technical scope, schedule, and financial requirements and metrics. · Managing job controls to ensure compliance with technical requirements, con ...

Join us as a Project Engineer for the FBM Avionics directorate where you will be involved in planning and executing avionics work scope and program execution. · Ensure that projects are completed on cost and schedule following established procedures, schedules, and work plans · C ...

The Construction Project Engineer is responsible for supporting the execution of assigned projects and the achievement of the project's technical scope, schedule, and financial requirements and metrics. · ...

The mission matters. So do the people behind it. With advancing defense technology at our core, what sets us apart is a culture of collaboration, purpose, and impact. · We help keep this nation and our allies secure. ...

The Avionics Program Management team seeks a Project Engineer to oversee the full lifecycle of both external and internal hardware production initiatives. · Lead planning, organization, control integration execution avionics missile‑body manufacturing electrical ground‑support eq ...

As Project Engineer responsible for Program Integration you will ensure end-to-end integration of Operational related activities including support Program Reviews Quarterly Reviews Planning Meetings Technical Director Reviews Working Groups Lead/coordinate integration activities ...

The coolest jobs on this planet… or any other… are with Lockheed Martin Space. · At the dawn of a new space age, Lockheed Martin is a pioneer, partner, innovator and builder.We provide the resources, inspiration and focus—if you have the passion and courage to dream big, · then w ...

The mission matters.Soo do the people behind it.With advancing defense technology at our core.what sets us apart is a culture of collaboration,purpose,and impact. · ...

The FBM Program is experiencing significant growth and we need your expertise to deliver amazing new technologies to our customers while maintaining the technical requirements of the strategic deterrence. · Learn about the Trident II D5 Fleet Ballistic Missile. · We offer unique ...

The mission matters. So do the people behind it. · ...

The mission matters. So do the people behind it. With advancing defense technology at our core, what sets us apart is a culture of collaboration, purpose, and impact.By bringing together people that use their passion for purposeful innovation, at Lockheed Martin we keep people sa ...

AsaProjectEngineerSrfortheFBMWeaponssystemInfrastructure&CapabilitiesWSICTeam,you'llworkonabroadrangeofprojectstofindinnovativesolutionstoleadteammembersinsolvingcomplexproblemsaswepositiontheprogramforsustainedsuccessfordecades-to-come. · ...

The design team member will support design and construction of Weapons System Infrastructure & Capabilities (WSIC) projects. · Developand reviewfacilityengineeringdesignpackagesincludingdrawingsandsketches, · technical specifications,and cost estimates. · ...

MANTech seeks highly talented Launch Vehicle Project Engineer with skills and experience related to launch vehicle systems, project management. · ...