Project Engineer, Sr. - Cape Canaveral, FL
1 month ago

Job summary
The mission matters. So do the people behind it.
Job description
, consectetur adipiscing elit. Nullam tempor vestibulum ex, eget consequat quam pellentesque vel. Etiam congue sed elit nec elementum. Morbi diam metus, rutrum id eleifend ac, porta in lectus. Sed scelerisque a augue et ornare.
Donec lacinia nisi nec odio ultricies imperdiet.
Morbi a dolor dignissim, tristique enim et, semper lacus. Morbi laoreet sollicitudin justo eget eleifend. Donec felis augue, accumsan in dapibus a, mattis sed ligula.
Vestibulum at aliquet erat. Curabitur rhoncus urna vitae quam suscipit
, at pulvinar turpis lacinia. Mauris magna sem, dignissim finibus fermentum ac, placerat at ex. Pellentesque aliquet, lorem pulvinar mollis ornare, orci turpis fermentum urna, non ullamcorper ligula enim a ante. Duis dolor est, consectetur ut sapien lacinia, tempor condimentum purus.
Access all high-level positions and get the job of your dreams.
Similar jobs
Project Engineer
1 month ago
The FBM program needs a Project-Engineering-focused professional who will plan, schedule, write, integrate and control the lifecycle of all technical data product that support war-fighter operations missile-system assembly test and maintenance. · ...
Project Engineer
1 month ago
The Lockheed Martin Fleet Ballistic Missile (FBM) team has supported the U.S. Navy's mission to provide an affordable and credible strategic defense for over 60 years. · We offer unique career opportunities and challenges on a program with a rich history and exciting future. We h ...
Project Engineer
1 week ago
This position performs work on the UK Technical Support Contract (TSC) of the Fleet Ballistic Missile (FBM) Program in support of the US/UK Polaris Sales Agreement. · Coordinate programmatic and technical solutions between LM, the US Navy, and the UK related to the UK's TRIDENT I ...
Project Engineer
1 month ago
The FBM program needs a Project-Engineering-focused professional who will plan, schedule, integrate and control the lifecycle of all technical data product that support war-fighter operations missile-system assembly test and maintenance. · Assist with schedule development – updat ...
Project Engineer
1 month ago
Protecting what matters most is the mission that matters most. · ...
Project Engineer
1 month ago
Protecting what matters most is the mission that matters most. Space is a critical domain, connecting our technologies, our security and our humanity. · ...
Construction Project Engineer
1 month ago
The Construction Project Engineer is responsible for supporting the execution of assigned projects and the achievement of the project's technical scope, schedule, and financial requirements and metrics. · ...
Construction Project Engineer
1 month ago
The Construction Project Engineer is responsible for supporting the execution of assigned projects and the achievement of the project's technical scope, schedule, and financial requirements and metrics. · Managing job controls to ensure compliance with technical requirements, con ...
Project Engineer Sr
1 week ago
The design team member will support design and construction of Weapons System Infrastructure & Capabilities (WSIC) projects. · Develop and review facility engineering design packages. · Evaluate designs for compliance with engineering principles. · ...
Associate Project Engineer
3 weeks ago
Join us as a Project Engineer for the FBM Avionics directorate where you will be involved in planning and executing avionics work scope and program execution. · Ensure that projects are completed on cost and schedule following established procedures, schedules, and work plans · C ...
Project Engineer Sr
18 hours ago
The Avionics Program Management team seeks a Project Engineer to oversee the full lifecycle of both external and internal hardware production initiatives. · Lead planning, organization, control, integration, and execution of avionics missile‑body manufacturing, electrical ground‑ ...
Project Engineer Sr
2 weeks ago
The Avionics Program Management team seeks a Project Engineer to oversee the full lifecycle of both external and internal hardware production initiatives. · Lead planning, organization, control integration execution avionics missile‑body manufacturing electrical ground‑support eq ...
Project Engineer Staff
1 day ago
The mission matters. So do the people behind it. With advancing defense technology at our core, what sets us apart is a culture of collaboration, purpose, and impact. · We help keep this nation and our allies secure. ...
Project Engineer Sr
1 day ago
As Project Engineer responsible for Program Integration you will ensure end-to-end integration of Operational related activities including support Program Reviews Quarterly Reviews Planning Meetings Technical Director Reviews Working Groups Lead/coordinate integration activities ...
Project Engineer Sr
1 week ago
The coolest jobs on this planet… or any other… are with Lockheed Martin Space. · At the dawn of a new space age, Lockheed Martin is a pioneer, partner, innovator and builder.We provide the resources, inspiration and focus—if you have the passion and courage to dream big, · then w ...
Associate Project Engineer
2 weeks ago
The FBM Program is experiencing significant growth and we need your expertise to deliver amazing new technologies to our customers while maintaining the technical requirements of the strategic deterrence. · Learn about the Trident II D5 Fleet Ballistic Missile. · We offer unique ...
Project Engineer, Sr.
2 weeks ago
The mission matters.Soo do the people behind it.With advancing defense technology at our core.what sets us apart is a culture of collaboration,purpose,and impact. · ...
Project Engineer, Sr.
3 weeks ago
The mission matters. So do the people behind it. With advancing defense technology at our core, what sets us apart is a culture of collaboration, purpose, and impact.By bringing together people that use their passion for purposeful innovation, at Lockheed Martin we keep people sa ...
Project Engineer Sr, Milcon
1 month ago
AsaProjectEngineerSrfortheFBMWeaponssystemInfrastructure&CapabilitiesWSICTeam,you'llworkonabroadrangeofprojectstofindinnovativesolutionstoleadteammembersinsolvingcomplexproblemsaswepositiontheprogramforsustainedsuccessfordecades-to-come. · ...
Project Engineer Sr, Civil
1 month ago
The design team member will support design and construction of Weapons System Infrastructure & Capabilities (WSIC) projects. · Developand reviewfacilityengineeringdesignpackagesincludingdrawingsandsketches, · technical specifications,and cost estimates. · ...