Partner Sales Director - Maine

This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Senior Sales Director - REMOTE. This role is pivotal in driving results within a dedicated business domain while actively exploring new business opportunities. As a leader, you wil ...

This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Sales Enablement Director - REMOTE. In this role, you will lead initiatives to enhance the skills and productivity of our sales teams by developing and implementing effective enabl ...

What We Need  · Corpay is currently looking to hire a Director of Strategic Sales – Construction within our Corporate Payments division, which provides a comprehensive suite of online B2B payment solutions from AP automation to commercial expense cards and bill payment. This posi ...

This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Fixed Income Sales Director - REMOTE. In this role, you will drive revenue growth by establishing strategic relationships with institutional clients. Your expertise will guide comp ...

Position Overview: · The Territory Manager is responsible for supporting the Area Sales Manager in delivering on capital commitments with the sale of Tablo in new and existing locations. The Territory Manager will implement targeted business plans including prospecting greenfield ...

The Senior Director of Merchant Services is a high-impact leadership role responsible for driving strategy and revenue growth. This role accelerates speed-to-revenue by modernizing existing infrastructure and streamlining technical onboarding. · ...

The Director leads WEX Health & Benefits' Enablement Center of Excellence (CoE) and is responsible for defining enablement strategy, · building operating plans, and ensuring scalable repeatable execution across the organization. · The role sets standards frameworks tools best pra ...

WEX simplifies the business of running a business through smarter workflows and financial intelligence. Our North America Mobility and OTR businesses power the fleets that keep commerce moving — from small owner-operators to large fleet enterprises. · As our portfolio evolves acr ...

This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Sales Director - REMOTE. In this role, you will lead the sales function in the US, fostering the growth of our regional presence. You will be responsible for building and scaling t ...

About The Team/Role · The · Sales Coordinator · is responsible for responding to Requests for Proposal, assisting Sales Directors in various areas (assembling materials, in-office support while Sales Directors travels, follow-up questions, including consultant calls and presentat ...

The Center Store Operational Specialist is responsible for engaging, coaching and developing department managers and their teams for the maximization of sales and profits; enhanced merchandising; service first; improved shrink; excellence in execution plus the selection, developm ...

EvoSkin seeks a motivated Sales Representative to promote advanced aesthetic laser technologies. · ...

The Senior Director of Merchant Services is a high-impact leadership role responsible for driving strategy and revenue growth. · ...

This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Senior Sales Director - REMOTE. · We are looking for someone who will shape the sales vision and drive revenue growth across the Americas region. · ...

The Senior Director Bill Pay is the executive owner and leader responsible for defining and executing the long-term commercial and operational strategy for the bill pay portfolio. This individual is accountable for the P&L impact multi-year revenue attainment operational function ...

This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Senior Director, Sales & CS Operations - REMOTE. In this pivotal role, you will be at the forefront of transforming sales operations within a global enterprise setting. You will dr ...

· This position is posted by Jobgether on behalf of a partner company. We are currently looking for a Senior Surgical Account Manager - REMOTE. In this exciting role, you will have the opportunity to make a significant impact on healthcare access and equity by working remotely w ...

The Wex FP&A team is seeking a senior financial analyst to support the SVP of Revenue Marketing and the Global Marketing team. · ...

AboutWEX · WEXisainnovativepaymentstechcompanyleadingthewayinarapidlychangingenvironment.Wearepassionateaboutprovidingpaymentsolutionswithunparalleledsecurityandcontrolforcorporatepurchasingandtransactionmonitoringneeds.Developandexecuteglobalssalestrategyformulti-productsaasport ...

The Director of Health Operational Compliance provides leadership direction and integration of compliance activities to meet all relevant requirements ensuring compliance with applicable state and federal laws and regulations governing WEX Healths products services. · Oversee ma ...