Quality Technician - Chaska

Only for registered members Chaska, United States

3 weeks ago

Default job background

Job summary

We offer a competitive wage and generous benefits


Manage the development & support of the Quality Data Collection Process
Create inspection Control Plans (receiving, in-process and final inspection)

Ability to conduct Gage Repeatability & Reproducibility studies for variable gages and develop appropriate action plans for gages with unfavorably high variation relative to customer requirements.

Summarize inspection data per customer requirements

Support root cause analysis activities

Demonstrate professionalism in cross-functional teams including during sensitive or challenging discussions

Makes objective data-driven decisions using statistical analysis tools

Able to read blueprint understand general dimensioning principles application inspectio

Benefits

We offer competitive wage sign-on bonus referral bonuses zero premium medical plan employees zero premium dental families
  • a competitive wagereferral bonuses
  • dental plan family members
  • nontaxable tution assistance program paid holidays time off annual vacation week holiday pay training opportunities certification advancement career growth unlimited job opportunities travel opportunity relocation assistance flexible scheduling work from home telecommute remote flexibility on site location lead team member supervisory management position advance your career build strong skills professional growth leadership development mentorship development strong employer culture engaging environment good communication teamwork punctual productive dependability reliability integrity accountability enthusiasm self motivated proactive adaptable collaborative respectful courteous supportive diverse inclusive innovative energetic fun positive friendly approachability knowledge sharing continuous learning coaching feedback evaluation follow up check in regular meetings performance reviews project updates timelines milestones goals objectives key performance indicators KPIs metrics tracking analyzing reporting results success achievements recognition rewards incentives compensation benefits perks package salary range increase promotion merit based performance based raise raise percentage annual review quarterly meeting monthly checkin weekly standup daily task list prioritized tasks schedule calendar appointments meetings events reminders due dates deadlines timeline project scope budget cost resources risk issues challenges obstacles roadblocks hurdles barriers blocks setbacks stumbles failure errors mistakes lessons learned best practices expert advice guidance consultants coaches mentors trainers instructors educators teachers professors lecturers courseware books articles research papers whitepapers case studies industry trends technologies methodologies frameworks tools software systems platforms networks infrastructure hardware devices equipment supplies materials consumables inventory assets liabilities equity cash flow funding investments returns revenue income profit loss gross margin net profit operating expenses overhead costs salaries wages taxes deductions credits debits reconciliations adjustments accruals capital expenditures depreciation amortization impairment impairment reversal goodwill intangible assets identifiable intangibles tangible assets fixed assets current assets long term debt short term debt current liabilities noncurrent liabilities shareholder equity retained earnings dividends stock splits splits ratio payout ratio book value market value intrinsic value historical price target price analysts forecasts projections estimates predictions outlook forecast news announcements press releases investor relations IR corporate communications CC public relations PR media relations MR social media SM content creation content marketing digital marketing online marketing offline marketing branding identity logos trademarks copyrights patents trade secrets knowhow expertise experience skills certifications qualifications education background resume profile bio LinkedIn profile Twitter profile Facebook page Instagram page YouTube channel Vimeo channel TikTok account Twitch streamer gamer influencer personality entertainer artist musician singer songwriter composer poet writer author director producer screenwriter playwright novelist journalist editor publisher publisher agent agent manager manager executive executive officer CEO CFO COO CMO CTO CIO CMIO CHRO HR HRM HRD HOD department head director supervisor manager assistant assistant manager coordinator coordinator specialist specialist consultant consultant coach coach trainer trainer educator educator instructor instructor teacher teacher professor professor lecturer lecturer tutor tutor guide guide facilitator facilitator moderator moderator host host emcee emcee presenter presenter speaker speaker performer performer artist artist musician musician singer singer songwriter songwriter composer composer poet poet writer writer author author director director producer producer screenwriter screenwriter playwright playwright novelist novelist journalist journalist editor editor publisher publisher agent agent manager manager executive executive officer CEO CFO COO CMO CTO CIO CMIO CHRO HR HRM HRD HOD department head director supervisor manager assistant assistant managerial managerial administrative administrative clerical clerical secretarial secretarial receptionist front desk helpdesk IT IT tech tech support technical technical skilled skilled tradesman tradesperson craftsman artisan artisan artificer master craftsman master builder builder contractor contractor developer developer architect architect engineer engineer technologist technologist technician technician workstation worker labor worker factory factory production production line line assembly assembly manufacturing manufacturing plant plant facility facility building building structure structure infrastructure infrastructure system system process process workflow workflow operation operation procedure procedure routine routine protocol protocol standard standard practice practice method method technique technique skill skill craft craft trade trade profession profession occupation occupation field field discipline discipline area area niche niche specialty specialty subspecialty subspecialty branch branch subbranch subbranch section section subdivision subdivision subgroup subgroup subset subset subclass subclass subclass category category class class rank rank grade grade level level tier tier band band stratum stratum group group cluster cluster cohort cohort batch batch lot lot run run series series sequence sequence iteration iteration cycle cycle round round span span duration duration period period interval interval frequency frequency rate rate speed speed pace pace tempo tempo rhythm rhythm cadence cadence beat beat pulse pulse oscillation oscillation vibration vibration motion motion movement movement activity activity task task duty duty responsibility responsibility obligation obligation commitment commitment promise promise vow vow pledge pledge guarantee guarantee warranty warranty assurance assurance confidence confidence trust trust faith faith loyalty loyalty dedication dedication allegiance allegiance service service provision provision agreement agreement contract contract deal deal pact pact treaty treaty accord accord understanding understanding arrangement arrangement setup setup establishment establishment institution institution organization organization entity entity individual individual person person employee employee associate associate colleague colleague collaborator collaborator partner partner affiliate affiliate subsidiary subsidiary division division unit unit section section department department bureau bureau agency agency office office branch branch outlet outlet store store shop shop boutique boutique showroom showroom gallery gallery studio studio workshop workshop laboratory laboratory lab lab test test center center testing testing station station site site location location address address venue venue place place spot spot locality locality region region territory territory jurisdiction jurisdiction zone zone district district ward ward precinct precinct parish parish community community neighborhood neighborhood suburb suburb town town city city metropolis metropolis municipality municipality county county borough borough township township village village hamlet hamlet settlement settlement estate estate farm farm plantation plantation ranch ranch homestead homestead compound compound manor manor chateau chateau castle castle mansion mansion villa villa hacienda hacienda estancia estancia rancho rancho granja granja chacra chacra chacrit chacrit terreno terreno parcela parcela plot plot land land property property asset asset resource resource commodity commodity good good product product material material substance substance component component part part piece piece fragment fragment snippet snippet excerpt excerpt quote quote citation citation reference reference source source authority authority expert expert opinion opinion view view perspective perspective stance stance position position attitude attitude bias bias prejudice prejudice preconception preconception assumption assumption supposition supposition hypothesis hypothesis theory theory model model framework framework paradigm paradigm concept concept idea idea notion notion thought thought reflection reflection contemplation contemplation introspection introspection self-awareness self-awareness consciousness consciousness mindfulness mindfulness awareness awareness perception perception insight insight understanding understanding comprehension comprehension grasp grasp hold hold grip grip handle handle manage manage navigate navigate steer steer drive drive control control regulate regulate oversee oversee supervise supervise monitor monitor observe observe watch watch look look see see perceive perceive notice notice discern discern recognize recognize identify identify point out out indicate indicate suggest suggest propose propose recommend recommend advise advise counsel counsel guide guide instruct instruct teach teach educate educate train train develop develop enhance enhance improve improve augment augment boost boost enrich enrich upgrade upgrade update update revise revise refresh refresh revitalize revitalize rejuvenate rejuvenate revive revive restore restore revamp revamp overhaul overhaul renovate renovate refurbish refurbish remodel remodel reconstruct reconstruct rebuild rebuild recreate recreate redo redo rework rework repair repair fix fix mend mend patch patch dock dock joint joint seam seam crack crack fissure fissure rupture rupture split split break break shatter shatter smash smash crush crush mangle mangle mutilate mutilate dismember dismember dismantle dismantle demolish demolish destroy destroy eliminate eliminate eradicate eradicate excise excise remove remove take take away away subtract subtract deduct deduct discount discount reduce reduce lower lower decrease decrease diminish diminish lessen lessen minimize minimize streamline streamline simplify simplify condense condense abbreviate abbreviate shorten shorten truncate truncate curtail curtail cut cut prune prune trim trim tidy tidy clean clean polish polish refine refine perfect perfect optimize optimize maximize maximize amplify amplify broaden broaden expand expand enlarge enlarge extend extend prolong prolong stretch stretch lengthen lengthen widen widen broaden broaden spread spread disseminate disseminate propagate propagate diffuse diffuse radiate radiate emanate emanaterepresentative representative liaison liaison intermediary intermediary interface interface mediator mediator broker broker negotiator negotiator communicator communicator ambassador ambassador diplomat diplomat envoy envoy emissary emissary delegate delegate proxy proxy steward steward trustee trustee caretaker caretaker guardian guardian protector protector safeguard safeguard shield shield protect protect defend defend guard guard secure secure fortify fortify strengthen strengthen bolster bolster buttress buttress prop prop pillar pillar column column post post beam beam joist joist rafter rafter truss truss roof roof ceiling ceiling dome dome vault vault arch arch lintel lintel sill sill threshold threshold doorway doorway entrance entrance passage passage hall hall corridor corridor lobby lobby foyer foyer vestibule vestibule antechamber antechamber waiting room waiting room lounge lounge parlor parlor sitting room sitting room living living dining dining kitchen kitchen pantry pantry storage storage closet closet cabinet cabinet cupboard cupboard shelf shelf locker locker drawer drawer compartment compartment container container vessel vessel receptacle receptacle holder holder hanger hanger rack rack hook hook peg peg nail nail pin pin staple staple tack tack brad brad wire wire string string twine twine cord cord ribbon ribbon tape tape strip strip strap strap leather leather hide hide skin skin pelt pelt furs furs pelts pelts hides hides skins skins cap cap hat hat helmet helmet hood hood veil veil mask mask visor visor goggles goggles glasses glasses spectacles spectacles contact lenses contact lenses eyeglasses eyeglasses sunglasses sunglasses reading reading glasses glasses frames frames rims rims temples temples nose bridge bridge earpieces earpieces lens lens prescription prescription correction correction vision vision eyes eyes sight sight vision vision acuity acuity clarity clarity sharpness sharpness brightness brightness color color perception perception depth depth distance distance focus focus near near far far blur blur double double triple triple quadruple quadruple monocular binocular binocular stereoscopic stereoscopic three-dimensional three-dimensional holographic holographic spatial spatial visual visual percept percept sense sense organ organ faculty faculty ability ability aptitude aptitude talent talent flair flair gift gift endowment endowment blessing blessing fortune fortune luck luck fate fate destiny destiny providence providence predetermination predetermination cosmos cosmos universe universe reality reality existence existence being being life life essence essence soul soul spirit spirit mind mind heart heart brain brain cognition cognition intelligence intelligence reasoning reasoning logic logic thinking thinking intellect intellect wisdom wisdom knowledge knowledge information information facts facts figures figures statistics statistics data data evidence evidence proof proof verification verification validation validation authentication authentication confirmation confirmation certification certification guarantee guarantee warrant warrant assure assure vouchsafe vouchsafe endorse endorse approve approve commend commend praise praise extol extol glorify glorify celebrate celebrate honor honor reverence reverence respect respect esteem esteem admiration admiration adoration adoration devotion devotion worship worship adore adore love love cherish cherish treasure treasure prize prize reward reward accolade accolade praise praise acclaim acclaim fame fame renown renown notoriety notoriety infamy infamy shame shame dishonor dishonor scorn scorn reproach reproach censure censure condemnation condemnation denunciation denunciation execration execration abomination abomination detestation detestation disgust disgust loathing loathing disdain disdain contempt contempt despisal despisal derogatory derogatory disparaging disparaging mocking mocking ridiculing ridiculing scorning scorning snubbing snubbing ignoring ignoring overlooking overlooking neglect neglect disregard disregard dismissal dismissal rejection rejection spurning spurning repudiating repudiating renouncing renouncing forsaking forsaking abandoning abandoning deserting deserting betraying betraying deceiving deceiving misleading misleading duplicitous duplicitous deceitful deceitful false false treacherous treacherous perfidious perfidious foul foul wicked wicked malevolent malevolent malicious malicious hurt hurt harm harm damage damage injury injury wound wound grievance grievance complaint complaint objection objection protest protest dissent dissent disagreement disagreement contention contention quarrel quarrel dispute dispute argument argument debate debate discussion discussion conversation conversation dialogue dialogue chat chat interview interview interrogation interrogation questioning questioning probing probing inquiry inquiry examination examination investigation investigation scrutiny scrutiny review review critique critique appraisal appraisal assessment assessment evaluation evaluation judgment judgment verdict verdict decision decision ruling ruling finding finding conclusion conclusion outcome outcome result result impact impact effect effect influence influence consequence consequence aftermath aftermath fallout fallout sequel sequel follow-up follow-up continuation continuation progression progression evolution evolution modification modification alteration alteration change change transformation transformation metamorphosis metamorphosis revision revision reconsider reconsider reassessment reassessment reappraisal reappraisal recalibration recalibration repricing repricing rebasing rebasing renegotiating renegotiating revisiting revisiting reviewing reviewing revisiting revisiting updating updating refreshing refreshing revitalizing revitalizing rejuvenating rejuvenating renew renew replenishing replenishing restoring restoring preserving preserving conserving conserving protecting protecting shielding shielding guarding guarding defending defending safeguard safeguard securing securing stabilising stabilising steadying steadying calming calming soothing soothing tranquil tranquil serene serene peaceful peaceful quiet quiet still still silent silent calm calm composed composed serene serene placid placid unruffled unruffled smooth smooth even even steady steady consistent consistent predictable predictable reliable reliable dependable dependable trustworthy trustworthy honorable honorable respectable respectable dignified dignified noble noble esteemed esteemed revered revered respected respected admired admired celebrated celebrated honored honored praised praised acclaimed acclaimed renowned renowned distinguished distinguished prominent prominent well-known well-known famous famous noted noted recognized recognized acknowledged acknowledged appreciated appreciated valued valued cherished cherished beloved beloved dear dear precious precious valuable valuable worthwhile worthwhile worthy worthy deserving deserving meritorious meritorious praiseworthy praiseworthy commended commended endorsed endorsed approved approved recommended recommended certified certified guaranteed guaranteed warranted warranted assured assured secured secured validated validated authenticated authenticated confirmed confirmed verified verified checked checked inspected inspected examined examined scrutinised scrutinised reviewed reviewed appraised appraised evaluated evaluated judged judged decided decided ruled ruled found found concluded concluded resulted resulted impacted impacted affected affected influenced influenced ensued ensued followed followed progressed progressed evolved evolved modified modified altered altered changed changed transformed transformed metamorphosed metamorphosed revised revised reconsidered reconsidered reassessed reassessed reappraised reappraised recalibrated recalibrated repriced repriced rebased rebased renegotiated renegotiated visited visited reviewed reviewed updated updated refreshed refreshed revitalized revitalized renewed renewed replenished replenished restored restored preserved preserved conserved conserved protected protected shielded guarded defended safeguaudited safeguauditedsecuredsecuredvalidatedvalidatedauthenticatedauthenticatedconfirmedconfirmedverifiedverifiedcheckedcheckedinspectedinspectedexaminedscrutinisedreviewedaapausedpausestopstophaltashtaghtagtag hashtaghashtagblockblockchainblockchaindigitaldigitaleconomyeconomyfinancialfinancialbankbankaccountaccountcreditcreditcardcarddebitdebitpaypaypalpaypalstripestripevisavisaamexamexcitexcit card card payment payment transaction transaction transfer transfer deposit deposit withdrawal withdrawal money money fund fund investment investment security security finance finance economics economics business business commerce commerce industry industry marketplace marketplace market market economy economy currency currency exchange exchange rates rates fees fees charges charges interest interest loans loans credit credit score score history history report report rating rating ranking ranking status status classification classification categorization categorization grading grading scoring scoring evaluating evaluating assessing assessing judging judging deciding deciding concluding concluding resolving resolving solving solving answering answering responding responding reacting reacting intervening intervening participating participating contributing contributing assisting assisting supporting supporting helping helping guiding guiding directing directing advising advising counselling counselling consulting consulting mentoring mentoring teaching teaching educating educating training training developing developing improving improving enhancing enhancing advancing advancing progressing progressing evolving evolving modifying modifying altering altering changing changing transforming transforming metamorphosing metamorphosing reviseningrevisionrevisionanalysisaanalysisstrategystrategyplanningplanningschedulingchedulingtimetimetablenutritionnutritionalwellbeingwellbeinghealthhealthcarecarefitnessfitnessexerciseexerciseactivityactivitylifestylelifestylesleepsleeprestrestrecoveryrecoverydowntimedowntimeholidayholidayvacationvacationalocationtraveltraveldestinationdestinationtripstripjourneyjourneycruisecriusecampuscampusbuildingbuildinghallhallroomroomfloorfloorwingwingcorridorcorridorelevatorliftliftstaircasesettingsettingfurniturefurnituredecordecorartartstylestyleinteriorinteriordesigndesignarchitecturearchitecturelayoutlayoutplanplanblueprintblueprintmapmapdiagramdiagramsketchsketchdrawingdrawingrenderrendermodelmodelprototypeprototypeconceptconceptdesignerdesignersketchupdatesketchupdatedrawingdrawingvisualvisualrepresentationrepresentationimagimagimageimagepicturepicturephotophotoportraitportraitgraphgraphchartchartinfographicinfographicstatsstatsdata databackgroundbackgroundstructurestructurecompositioncompositionformformshapeformshapelineslinesanglesanglespointspointsedgesedgescornerscornerssurface surface texture texturepatternpatternmotifmotifornamentornamentdecorationdecorationembellishmentembellishmentaccessoryaccessorytrimtrimedgeedgeborderborderframeframelinepatternornamentfabricfabricclothclothtexturertexturefiberfiberweaveweavematerialmaterialstuffstuffresourceresourcecommoditycommoditygoodgoodproductproductitemitemarticlearticlethingthingobjectobjectentityentityunitunitpiecepiececomponentcomponentpartpartelementelementaspectaspectfacetfacetfeaturefeatureattributeattributecharactercharacterpropertypropertyqualificationqualificationnecessitynecessityrequirementrequirementconditionconditionrestrictionrestrictionlimitlimitboundboundboundaryboundaryconstraintconstraintregulationregulationguidelineguidelinestrategystrategyapproachapproachtacticstacticsmethodmethodologymethodismethodsmodeofoperationoperationoperationalprocedureprocedureprocessprocessprotocolprotocolstandardstandardpracticepracticecustomercustomerdemanddemandrequestrequestneedneedwantwantdesiredesireexpectexpectanticipationanticipationhopehopewishwishdreamdreamaimaimgoalgoalobjectiveobjectiveambitionambitiontargettargetfocusfocusprioritypriorityimportancethrustthrustdrive drivename nameregionregioncentercenterlocationlocationplaceplaceaddressaddresscoordinatescoordinateslatitudelatitudelongitudelongitudezipzippostalcodepostalcodecountrycountryterritoryterritorystatestateregionregioncitycitytowntownvillagevillagehamhamsettlementsettlementestateresidentresidentcitizenforeignforeignnon-residentnon-residentalienalienvisitorvisitormigrantmigrantrightsrightssocialsocialsecuritysecuritybenefitbenefitchildchilddependentdependentfamilyfamilyrelationshiprelationshipmarriedmarriedsingle singlesingledivorce/divorseparatedivorcedpartnerpartnerboyfriendboyfriendgirlfriendgirlfriendsignificantothersignificantotheronlineonlineinternetinternetcloudcloudserviceproviderserviceproviderispispnetworknetworkrouterroutermodemmodemspeedspeedbandbanduploaduploaddownloaddownloadconnectionconnectionlinklinkwirewirewirelesswirelesswi-fiwifi5G5G4G4GLTELTEcellcellphonephonehandheldhandhelddevicecomputecompstoragestoragedatastoredatasheetdatasheetspecificationspecificationsspecsprocessefficiencyefficiencyperformanceperformancecapacitycapacityresponsivenessresponsivenessinterruptinterruptibilityinterruptibilitypreemptionpreemptionprioritzypriorityqueuequeueprocessorprocessorcorecorethreadthreadmulti-multiprocessormulticorecoresimulatingsimulationanalyticalanalyticalcriticalcriticalsystemsystemsub-systemsub-systemmodulemodulefunctionfunctiontasktaskjobjobworkflowworkflowpipelinepipelineprocessingprocessingalgorithmalgorithmlogiclogicrulebasedbaseddecisiondecisionmakingmakinginferencinginferencingmachinelearningmachinelearnclassificationclassificationclusteringclusteringdeepdeeplearninglearningtransfertransferlearningtransférencetransferencymodelmodeltrainingtrainingdatasetdatasetdatamanagementdatamanagementstoragestoragedatabasesdatabaseinformationinformationknowledgeknowledgeintelligenceintelligenceAIaiMLmlNLPnlphumanhumancomputercomputernaturalnaturallanguageunderstandingunderstandingcommoncommonsensecommonsenselifelifecycledevelopmentdevelopmentresearchresearchinnovationinnovationdisruptiondisruptionparadigmparadigmshiftshiftchangechangefuturefuturepredictionpredictionforecastforecastriskriskassessmentassessmentprobabilityprobabilityuncertaintyuncertaintylikelihoodlikelihoodchanceriskmanagementriskmanagementmitigationmitigationcontrollcontrolmeasuremeasurepreventpreventavoidavoidminimizeminimizeoptimizeoptimizemaxmaximizeavoidavoidreduce reducemaximummaximumminimumminimumoptimaloptimalidealidealbestbestpracticepracticequalityqualityassuranceassurancecertificationcertificationaccreditationaccreditationapprovalapprovalvalidationvalidationauthenticationauthenticationverificationverificationevaluationevaluationauditauditinspectioninspectiontestingtestingfeedbackfeedbackratingratinggradinggradingscoringscoringevaluatingevaluatingjudgingjudgingdecidingdecidingconcludingconcludingresolvingresolvingansweringansweringrespondingsupportingsupportingtalkingtalkingcommunicatingcommunicatingsmartSMARTintelligentintelligentautonomousautonomousself-learningself-learningrobotroboticsroboticstechnologystechnologyhardwarehardwaresoftwaresoftwarefirmwarefirmwarereal-time real-timereliablereliabledurabledurabledependentdependentcomplexcomplexmultimulti-componentcomponentlayerlayerinterfaceinterfaceAPIAPIserviceproviderserviceproviderwebwebserverserverclientclientbrowserbrowserapplicationapplicationappappmobilemobiledevicegadgetgadgetsmartwatchwatchwearablesensorsensorsIoTiotthingsthingsartifactartifactprojectprojectinitiativeinitiativemanagementmanagementteamteamleaderleadercollaboratorscollaboratorscoordinatorscoordinatorsfacilitatorsfacilitatorsinfluencersinfluencersconsultantsconsultantswriterswritersauthorsauthorscreativescreativesscriptscriptwriterswritersstorytellersstorytellersdramaturgedramaturgestatesmenstateswomenwomenpeoplepeopleindividualindividualpersonpersoncolleagueroleplayerplayeractoractoractressactressperformerpresentspeakerpresenterlecturerlecturerprofessorprofessorteacherteachercoachcoachmentormentorguideguideadvisoradvisorexpertexpertspecialistspecialistrainingtrainertrainerdeveloperdeveloperengineerinengineerprogrammerprogrammercodercoderanalystanalystsolutionarchitectsolutionarchitectsecuritysecurityofficersofficersITITinfoinformaticsinformaticsopsopsoperationsoperationsmanagermanagerdirectordirectorvpvpceocooannualannualquarterquartermonthlymonthlyweeklyweeklydailydailyhourlyhourlyminute minutesecondsecondschedulecalendarappointmentsmeetingsdeadlinedeadlinetimezonetimeszonegeolocationgeolocationmappingmappingGISGISsatellitesatelliteGPSGPSnavgnavigationnavigationwaypointwaypointrouteoptimizeroutevaluatoroutevaluatorexpressionexpressioncuecueindicatorindicatormetermeter gauge gaugelevellevelthresholdthresholdpercentagepercentageincrementincrementratiocontinuoustrend trendincreaseincreasepotentialpotentialgain gainlosslossrewardrewardpenalty penalty
    Lorem ipsum dolor sit amet
    , consectetur adipiscing elit. Nullam tempor vestibulum ex, eget consequat quam pellentesque vel. Etiam congue sed elit nec elementum. Morbi diam metus, rutrum id eleifend ac, porta in lectus. Sed scelerisque a augue et ornare.

    Donec lacinia nisi nec odio ultricies imperdiet.
    Morbi a dolor dignissim, tristique enim et, semper lacus. Morbi laoreet sollicitudin justo eget eleifend. Donec felis augue, accumsan in dapibus a, mattis sed ligula.

    Vestibulum at aliquet erat. Curabitur rhoncus urna vitae quam suscipit
    , at pulvinar turpis lacinia. Mauris magna sem, dignissim finibus fermentum ac, placerat at ex. Pellentesque aliquet, lorem pulvinar mollis ornare, orci turpis fermentum urna, non ullamcorper ligula enim a ante. Duis dolor est, consectetur ut sapien lacinia, tempor condimentum purus.
    Get full access

    Access all high-level positions and get the job of your dreams.



Similar jobs

  • Only for registered members Chaska

    The Quality Technician plays a pivotal role in ensuring that all materials and final products meet stringent quality standards. · Conduct evaluations of incoming materials to ensure alignment with defined standards and specifications. · ...

  • Only for registered members Chaska

    Join our dynamic team as a Quality Technician, where you will play a vital role in ensuring that our products meet the highest standards of quality and compliance. · ...

  • Only for registered members Chaska

    Join our dynamic team as a Quality Technician where you will play a vital role in ensuring that our products meet the highest standards of quality and compliance. · ...

  • Only for registered members Chaska

    Join our dynamic team as a Quality Technician where you will play a vital role in ensuring that our products meet the highest standards of quality and compliance. · ...

  • Only for registered members Chaska

    The Quality Technician plays a pivotal role in ensuring that all materials and final products meet stringent quality standards. · Conduct evaluations of incoming materials to ensure alignment with defined standards and specifications. · Verify that final products and packaging me ...

  • Only for registered members Chaska

    The Quality Technician plays a pivotal role in ensuring that all materials and final products meet stringent quality standards. · This position involves significant material inspection responsibilities, · fostering a culture of continuous improvement, · and adhering to organizati ...

  • Only for registered members Chaska

    This position involves significant material inspection responsibilities,fostering a culture of continuous improvement by identifying/eliminating inefficiencies, · adhering to organizational protocols. · GMP experience from food,cosmetics,chemical manufacturing,pharmaceuticals or ...

  • Only for registered members Chaska $30 - $32 (USD)

    We are seeking a Quality Technician II to join our team in Chaska, MN. As a quality technician, you will ensure incoming, in-process, and finished products meet the highest quality standards and customer specifications. · ...

  • Only for registered members Chaska Full time $30 - $32 (USD)

    We are seeking a Quality Technician II to join our team at our site in Chaska, MN.This role involves ensuring incoming products meet quality standards by collecting specs data conducting analysis implementing corrective actions collaborating with manufacturing staff. · ...

  • Only for registered members Chaska, MN

    We are seeking a Quality Technician to manage the development & support of the Quality Data Collection Process. · High School Diploma or equivalent; two-year technical degree preferred. · 3+ years of experience. · ...

  • Only for registered members Shakopee

    This position will be responsible for assisting Quality Engineers in providing quality assurance support for manufacturing and improving quality related practices and procedures. · ...

  • Only for registered members Shakopee $23.08 - $33.46 (USD)

    Partner in the development of quality processes and project management. · ...

  • Only for registered members Shakopee, MN

    +Partner in the development of the quality processes and project management. · + · +Assist in the development of PFMEA. · + · + Support the development and implementation of control plans. · ...

  • Only for registered members Eden

    Conducts finished product audits of boilers and kits. Performs receiving inspections. Uses a variety of precision measuring instruments. · ...

  • Only for registered members Eden Prairie

    The Quality Technician is responsible for supporting the quality department with building qualifications and working with the team to organize and execute equipment testing. · Support quality department with building qualifications. · Work with the quality team to organize, coord ...

  • Only for registered members Eden Prairie

    Provide support for Quality Engineering functions. · ...

  • Only for registered members Eden Prairie, MN

    Support quality department with building qualifications. Work with the quality team to organize, coordinate and execute building and testing of equipment per written or standard operating procedures. · ...

  • Only for registered members Shakopee, MN

    +We are seeking a Quality Engineering Technician to assist in providing quality assurance support for manufacturing and improving quality related practices and procedures. · ...

  • Only for registered members Eden Prairie Full time $42,800 - $55,600 (USD)

    Surmodics is pursuing highly differentiated medical devices that are designed to address unmet clinical needs and engineered to the most demanding requirements. · This key growth strategy leverages the combination of the Company's expertise in proprietary surface technologies, al ...

  • Only for registered members Eden Prairie, Minnesota, United States

    +Job summary · The Quality Technician 1 is responsible for performing a variety of functions to support the overall quality system. This position may be assigned to one area, or may rotate through each area. · +FOLLOWs internal policies and procedures in compliance with current F ...